PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00051.1.g02970.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 347aa    MW: 37498.2 Da    PI: 7.0808
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00051.1.g02970.1.sm.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like86.42.8e-27275325151
                         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                                     k r++W+peLH++Fv a++qLGG+++AtPk+i+elmkv+ Lt+++vkSHLQ
  Zjn_sc00051.1.g02970.1.sm.mkhc 275 KSRRCWSPELHRQFVAALNQLGGPQVATPKQIRELMKVDELTNDEVKSHLQ 325
                                     68************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.655272332IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-23273325IPR009057Homeodomain-like
SuperFamilySSF466896.63E-13273326IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-22275326IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MCSPSPPASC NSHPAHASAS HENCKFSFHR VRSASACEMG LDVGEIGMGA DLSLDLRHFA  60
SKAMKQTRSA LASDMDAYIR RLEEERGKIE VFRRELPICA RLLADVIDVI KEEAEKEKKD  120
DRDEEEEEDG ATGDKSKWMS TAQLWTSGSG RDAAEPEKQD SDKGRSSLEQ NSSGGAFTLF  180
NAVGSLAPAS GLRPRLRKDD DKAVGAGMPD LSLLSPPPIT SVPAAAAVES RRQVVGLAHA  240
AARAASVGGP ALCLQPHAQR TTPPPQPQQQ QQARKSRRCW SPELHRQFVA ALNQLGGPQV  300
ATPKQIRELM KVDELTNDEV KSHLQVSSAS LHLALPLSIH PPKNTCN
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1056251e-51AK105625.1 Oryza sativa Japonica Group cDNA clone:001-200-C11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002459272.11e-104hypothetical protein SORBIDRAFT_02g001600
TrEMBLA0A0A9H2111e-113A0A0A9H211_ARUDO; Uncharacterized protein
STRINGSb02g001600.11e-104(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP181737107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.11e-22G2-like family protein